PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25982.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 429aa    MW: 47671.1 Da    PI: 7.5185
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25982.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-15158205148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+WT+ Ed ll ++v+ +G g W+t +++ g+ R++k+c++rw +yl
  mrna25982.1-v1.0-hybrid 158 RGPWTPREDTLLTKYVEAHGHGLWRTLPKKAGLLRCGKSCRLRWMSYL 205
                              89******************************99***********997 PP

2Myb_DNA-binding49.88.1e-16211255147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+ T++Ed l+++ + +lG++ W++Ia +++ gRt++++k++w++ 
  mrna25982.1-v1.0-hybrid 211 RGNITPDEDNLIIRMHSLLGNR-WSLIAGRLP-GRTDNDIKNYWNTN 255
                              7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.814153205IPR017930Myb domain
SuperFamilySSF466894.12E-28155252IPR009057Homeodomain-like
SMARTSM007171.5E-11157207IPR001005SANT/Myb domain
PfamPF002492.1E-13158205IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-22159212IPR009057Homeodomain-like
CDDcd001675.12E-9160205No hitNo description
PROSITE profilePS5129425.938206260IPR017930Myb domain
SMARTSM007174.3E-16210258IPR001005SANT/Myb domain
PfamPF002492.8E-14211256IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-24213260IPR009057Homeodomain-like
CDDcd001675.61E-12215256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MVLITKGGIS TSRCNVVLTE EATGLIDGGG SFNDPDKCWA LVNSGMQEYG LKCGLGLGLS  60
PLCHLPFSSL LACLDQTCAS EKGAKMMKVE TRTPHKGWPT VENIVPDFLH NILILLMMKS  120
SPEACSGWLP GLDHDQAAIL RVGSDRHIDS FKPVGLHRGP WTPREDTLLT KYVEAHGHGL  180
WRTLPKKAGL LRCGKSCRLR WMSYLRPDIK RGNITPDEDN LIIRMHSLLG NRWSLIAGRL  240
PGRTDNDIKN YWNTNLRKRL LSEGTDPSTH QKLSQPPASK ENKSKTQQNH KAKNKNNNEK  300
SLVPEKPKVH IPNPTRVTSF VNLPRKDRFT TASTALSSSQ DEVLDHVNNV VIPWSDFKEG  360
GVVFSDCDWS SSNFECDQSR IIPNVAAGGD DYTGENIYEE YLQALLNTTD QDQNYPVELD  420
SFAESLLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-241562602105MYB PROTO-ONCOGENE PROTEIN
1a5j_A3e-241562605108B-MYB
1h8a_C3e-2415626025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6815460.0LN681546.1 Fragaria vesca mRNA for transcription factor MYB 12 (myb gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301157.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0A8WJ381e-164A0A0A8WJ38_FRAVE; Transcription factor MYB 12
STRINGPOPTR_0014s09630.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.16e-59myb domain protein 4